PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 314aa    MW: 35703.5 Da    PI: 8.0368
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926039.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.5e-5651301128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +kv++ ++++ ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_010926039.1   5 LPPGFRFHPTDEELITYYLIRKVSDFRFTA-KAIADVDLNKYEPWDLPGKASMGEKEWYFFSLRDRKYPTGMRTNRATDAGYWKTTGKDKEIFH- 97 
                     79*************************999.88***************988999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        lvg+kktLvfykgrapkgekt+Wvmheyrl
  XP_010926039.1  98 CAVLVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 130
                     99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-633151IPR003441NAC domain
PROSITE profilePS5100559.8375151IPR003441NAC domain
PfamPF023652.2E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLIRKVSDF RFTAKAIADV DLNKYEPWDL PGKASMGEKE  60
WYFFSLRDRK YPTGMRTNRA TDAGYWKTTG KDKEIFHCAV LVGMKKTLVF YKGRAPKGEK  120
TNWVMHEYRL HTKFPYRTTK EEWVVCRVFK KNSDIKKTQP NTSPLPPLLE SPCSATSLSE  180
LGELDVPTLS NLVYTSNGPD GMLTADNINN KVDMNMYMNW VLGREATSQP SLPWSSGLLS  240
MGYSPSPAIL KAMPFNGYQP QEATNLTSSS SFTVHGDPIL GNESKLSFPP SSFKGTEITQ  300
QEQPLDQESI WRGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-58415716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-58415716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-58415716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-58415716171NO APICAL MERISTEM PROTEIN
3swm_A2e-58415719174NAC domain-containing protein 19
3swm_B2e-58415719174NAC domain-containing protein 19
3swm_C2e-58415719174NAC domain-containing protein 19
3swm_D2e-58415719174NAC domain-containing protein 19
3swp_A2e-58415719174NAC domain-containing protein 19
3swp_B2e-58415719174NAC domain-containing protein 19
3swp_C2e-58415719174NAC domain-containing protein 19
3swp_D2e-58415719174NAC domain-containing protein 19
4dul_A2e-58415716171NAC domain-containing protein 19
4dul_B2e-58415716171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926039.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLM0TRJ51e-128M0TRJ5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P18420_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-98NAC domain containing protein 58